PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_62426.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 326aa    MW: 35082.3 Da    PI: 9.258
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_62426.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.3e-4057134178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +CqvegC ++l+ akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh lsefD++krsCrrrL++hn+rrrk+q+
  MLOC_62426.1  57 RCQVEGCGTELAAAKEYHRKHRVCEAHTKSPRVVVAGQERRFCQQCSRFHGLSEFDQKKRSCRRRLSDHNARRRKPQP 134
                   6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3351119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.76155132IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-3856137IPR004333Transcription factor, SBP-box
PfamPF031106.1E-3158131IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEWTAPKSTP SSPPHLLWDW GDAAALGSSG EAAGRRGKEK RARGEGAGGG GGGGGVRCQV  60
EGCGTELAAA KEYHRKHRVC EAHTKSPRVV VAGQERRFCQ QCSRFHGLSE FDQKKRSCRR  120
RLSDHNARRR KPQPDAFSFA PARLPSSLMF DDRRQISFVW DKDPLSHGRP FPCSPWDSPS  180
DFKPPQVKEI REVSINGQVH FDKSHLPNAV PALSHDIAEL LPMKGPDASA TASKLGGAPD  240
LQRALSLLSA SSCGLPDPVQ QASCLVQFTG ASQNSRGLPS PHGGSPPSAS CAEGQPMAPS  300
PQFVRFTMDG ASSGYESTFF GVNRMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2749131184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113130KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3616100.0AK361610.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1144O20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570368.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-94SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLM0XRS70.0M0XRS7_HORVD; Uncharacterized protein
STRINGMLOC_62426.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.36e-42squamosa promoter binding protein-like 2